Licensed Nursing Home Administrator (LNHA)
Medical Talent Pros
JobTitle: LicensedNursingHomeAdministrator(LNHA) Location: Chickasha, Oklahoma Type: Full-Time ReportsTo: RegionalDirectorofOperations AbouttheOpportunity Ourclientoperatesahighlyrated,well-established 100-bed skilled nursing and rehabilitation facility servingtheTulsacommunities.Theorganizationisknownforstrongleadership,exceptionalsurveyperformance,andaculturecenteredoncompassionate,person-directedcare. Weareseekinganexperiencedanddynamic LicensedNursingHomeAdministrator(LNHA) toprovidestrategicandoperationalleadership,ensuringexcellenceincaredelivery,regulatorycompliance,andstaffengagement. KeyResponsibilities Provideoverallleadershipanddailymanagementofallfacilityoperations. Ensurecompliancewithfederal,state,andlocalregulations,aswellascompanypoliciesandprocedures. Lead,coach,anddevelopdepartmentheadsandteammemberstopromoteapositive,high-performanceculture. Overseefinancialmanagement,includingbudgeting,censusdevelopment,andcostcontrol. Fosterstrongrelationshipswithresidents,families,physicians,andthesurroundingcommunity. Drivequalityimprovementinitiativestoenhanceresidentoutcomesandsatisfaction. Maintainopen,transparentcommunicationwithownershipandregionalleadershiponkeyoperationalmetrics. Qualifications Current OklahomaNursingHomeAdministratorLicense(LNHA) ingoodstanding. Minimum 3–5yearsofexperience asanAdministratorinaskillednursingorlong-termcarefacility. Provensuccesswithsurveyreadiness,censusgrowth,andteamdevelopment. StrongunderstandingofMedicare/Medicaidreimbursement,financialoperations,andcompliancestandards. Excellentleadership,communication,andinterpersonalskills. Aresults-orientedmindsetwiththeabilitytobalancequality,compliance,andoperationalefficiency. WhatWeOffer Competitive basesalary (commensuratewithexperience) Performance-basedbonuspotential Comprehensive health,dental,andvisionbenefits Supportiveregionalleadershipandautonomytomakeanimpactatthefacilitylevel Apositive,stableenvironmentwithalong-tenured,engagedstaff JoinaTeamThatValuesExcellence Ifyou’reamotivated,licensedadministratorwhotakesprideinleadingstrongteamsandachievingresults,we’dlovetohearfromyou.Thisisanexcellentopportunitytoleadathriving120-bedcommunitywithahistoryofsuccessandacommitmenttoresident-centeredcare. #J-18808-Ljbffr Medical Talent Pros
- Are you a hardworking nurse looking for an encouraging work environment? Do you want a supportive, well structured team? I f so, this job opportunity might be for you: We are seeking to add a Licensed Nurse (RN or LPN) to our team! At our facility, we recognize that nurses...SuggestedFull timeImmediate start
- Cottonwood Creek Skilled Nursing and Therapy is seeking a Licensed Nurse (RN or LPN) to join our team. You will administer medications and treatments, monitor residents, and communicate health changes to physicians and families. The role offers a supportive environment...SuggestedFull time
- ...Nurse Practitioner Opportunity At Sprinter Health Sprinter Health is an on-demand mobile... ...sends medical professionals to patients' homes to perform blood draws, diagnostic and... ...Practitioner Active Family Nurse Practitioner License in Oklahoma Consistently exhibits the...Suggested
$125 per hour
...Overview currently hiring Pe Diem dedicated Hospice Nurse Practitioners to deliver exceptional patient care in and around the Chickasha... ...experience as an RN or NP preferred. Holds current unencumbered license in the State of Practice as a Registered Nurse and Nurse...SuggestedDaily paidCurrently hiringFrontier Hospice LLC
Chickasha, OK4 days ago- ...Registered Nurse Case Manager SalariedAt Elara Caring, we have a unique opportunity to... ...play a huge role in the growth of an entire home care industry. Here, each employee has... ...Baccalaureate School of NursingCurrent State License as a Registered Nurse RN1 year of...SuggestedFull time
Elara Caring
Chickasha, OK2 days ago - Frontier Hospice is seeking Per Diem Hospice Nurse Practitioners to deliver compassionate medical care in and around Chickasha, OK. Responsibilities include assessments, care planning, and collaboration with families and the hospice team to ensure holistic, patient-centered...Daily paid
- Frontier Hospice is seeking dedicated Per Diem Hospice Nurse Practitioners to deliver compassionate patient care in and around Chickasha, OK. You will evaluate health histories, diagnose, and develop personalized care plans while collaborating with patients, families, and...Daily paid
- ...Registered Nurse Case Manager Salaried At Elara Caring, we have a unique opportunity... ...play a huge role in the growth of an entire home care industry. Here, each employee has... ...Baccalaureate School of Nursing ~ Current State License as a Registered Nurse RN ~1 year of...Full time
- ...play a huge role in the growth of an entire home care industry. Here, each employee has... ...Right Place. Job Description Registered Nurse Case Manager Salaried (JP506E) At Elara... ...Baccalaureate School of Nursing Current State License as a Registered Nurse RN 1 year of...Full time
- Elara Caring in Oklahoma is hiring a Registered Nurse Case Manager to support patients in their homes. You will assess needs, coordinate hospice and home health services, and guide families through the care plan. This salaried role requires RN licensure, at least 1 year...
- ...Chickasha, OK is seeking a compassionate LPN to join our daytime nursing team. You will supervise, coordinate and provide nursing care... ...centered care and resident choice. The role requires an active LPN license in good standing, supervisory experience preferred, and strong...Day shift
- ...Company That Puts People First! Licensed Practical / Vocational Nurse – LPN/LVN Schedule : Weekdays/weekend... ...Acuity: Feeding tube & med administration (Training Available) We are one of... ...Aveanna has a tablet in each patient’s home allowing for electronic...Weekly payDaily paidFull timePart timeFor contractorsReliefLocal areaFlexible hoursShift workNight shiftWeekend workDay shiftWeekday work
Aveanna Healthcare
Chickasha, OK10 days ago - Behavioral Health Care Manager II The primary responsibility of the certified Behavioral Health Care Manager II is to ensure implementation of the comprehensive care plan, which will include mental health goals, physical health goals, and other life domain goals for...Permanent employmentContract workWork at officeLocal areaImmediate start
- ...This is NOT a remote position. Make A Difference at Grady Memorial Hospital Nurses needed ER / ICU / Med/Surg / Surgery Med/Surg 7p-7a Registered Nurse Fulltime, Part-Time and Flex RN positions available BLS, ACLS, required, PALS, TNCC preferred ** FULL TIME RN SIGN...Full timePart timeRelocation packageFlexible hoursShift work
- ...opportunity to play a huge role in the growth of an entire home care industry. Here, each employee has the chance to make... ...Right Time, in the Right Place. Job Description: Licensed Vocational/ Practical Nurse Hourly At Elara Caring, we care where you are and believe...Hourly payFull timeRelief
Elara Caring
Chickasha, OK3 days ago - ...LPN- Pediatric Home Health NurseJob SummarySpecialty Care Pediatrics is looking for nurses who are compassionate and reliable. We provide... ...care, including assessments,Administration of medications, treatments,... ...: Facebook: RN or LPN license issued by a State Board of Nursing...Full timeTemporary workPart timeReliefFlexible hoursShift workNight shift
Specialty Care Pediatrics
Chickasha, OK4 days ago - Elara Caring is seeking a Licensed Vocational / Practical Nurse in Chickasha, Oklahoma. You will be responsible for patient care as outlined in the Plan of Care, ensuring a high level of communication with the Clinical Team Manager and RN Case Manager. This role requires...
- FastHealth Corporation seeks an ER RN for the Emergency Department in Chickasha, OK. This full-time night shift role runs 7p-7a with rotating weekends and holidays. Requires BLS, ACLS, and PALS certification; TNCC is preferred. The position is a patient-safety sensitive...Full timeFlexible hoursNight shift
- Job DetailsJob Location: Shanoan Springs - Chickasha, OK 73018Position Type: Full TimeLPN- Licensed Practical Nurse Day Shift We are looking for Caring and Compassionate Team Members! The following benefits are available to Full Time Team Members: Paid Time Off Major Medical...Full timeTemporary workLocal areaDay shift
- Job Posting ER RN - FT (72) Full-time Emergency Department Registered Nurse (7p-7a) Flexible Schedule, BLS, ACLS, PALS required, TNCC preferred. Rotating weekends/holidays. PATIENT SAFETY SENSITIVE POSITION. Additional Information Position Type : Full Time Shift : Night...Full timeFlexible hoursShift workNight shift
- ...and administers medication. Uses patient identifiers prior to administration of medication. Documents administration in required logs.... ...Graduate of an accredited program for Medical Assistant preferred. Licenses/Certification : MA course completion certification preferred...Full timePart timeAll shiftsShift work
- ...Pixel Innovations is seeking a compassionate Registered Nurse to join our team in the United States, providing quality patient care and... ...education and support. The role requires a valid US nursing license and a minimum of 2 years of RN experience, with preference for acute...
Pixel Innovations
Norge, OK6 hours ago $1,400 per month
...Registered Nurse We are looking for a compassionate and dedicated Registered Nurse to join our team in the United States. As a nurse,... ...This position requires an experienced nurse with a valid nursing license and a passion for helping others. Responsibilities Assess patients...Pixel Innovations
Norge, OK4 days ago$81.87 per hour
...policies, procedures, protocols, and regulatory requirements. Administration of the ACGME accreditation and reporting requirements to... ...OK State Board of Pharmacy. Required to maintain preceptor license through the OK State Board of Pharmacy upon hire. Required...Work experience placementRelocation packageNight shiftWeekend workAfternoon shiftWeekday workNorman Regional Health System
Alex, OK3 days ago$1,500 per month
Registered Nurse (RN) We are hiring a qualified Registered Nurse to join our team in the United States. As an RN, you will be responsible... ...procedures. The ideal candidate must have a valid nursing license and at least 1 year of experience. You must also have strong communication...Free visa$33 per hour
...residents. Our associates appreciate our safe, home-like, and fun work environment. s. Our... ...WHAT WILL YOU BE DOING? The Wellness Nurse assists the Resident Care Director with managing... ...providers. REQUIREMENTS Certification : Licensed Practical Nurse (LPN) or Registered Nurse...Hourly payDaily paidPart timeWork at officeLocal areaFlexible hoursShift work- RN Health Care Facility Surveyor - OklahomaImpact Recruiting Solutions is currently seeking a RN Health Care Facility Surveyor to fill an opening with a Quality Improvement Consulting Company and will work in a technically exciting environment supporting internal and external...Immediate start
GreenLife Healthcare Staffing
Amber, OK4 days ago
Do you want to receive more vacancies?
Subscribe and receive similar vacancies to Licensed Nursing Home Administrator (LNHA). Be the first to apply!
