Sign up to access all features of our service.
  • Job search
  • Favorites
  • Create a CV
    New
  • Salaries
  • Subscriptions

Paralegal - Legal Services - remote

$30 - $35 per hour

Lydecker LLP

If you possess a strong work ethic, exceptional organizational skills, strong attention to detail, and want to work in our growing defense litigation practice group, this may be the opportunity for you!

This is a hybrid for our office in LA 90014.

A minimum of 2 years of civil defense litigation experience, preferably in General Liability, Labor and employment, Personal Injury, or other civil defense litigation practice area; previous insurance defense litigation a huge plus.

Previous experience should include experience with calendaring, docketing, interfacing with court personnel, opposing counsel, clients and vendors, drafting basic pleadings and legal correspondence

Computer skills: Has basic knowledge of computer operation, internet software, spreadsheet software and word processing software; the use of Microsoft products is preferred. Has the ability to type and operate office equipment.

Detail-oriented with a keen eye for accuracy, proofreading, and editing legal documents for consistency and completeness

Associate degree or Bachelor degree a plus, but not required

Support attorneys by performing various administrative duties, such as maintaining calendars, managing hearings and deadlines, organizing case files, and coordinating logistics

Support attorneys by e-filing documents in state or federal court as needed

Expertly organize exhibits, documents, evidence, briefs, and appendices for efficient reference and retrieval (we use Clio)

Draft basic pleadings such as EOAs, Notices, Motions, discovery, under the supervision of the attorneys

Familiarity with Microsoft Outlook, Word, Excel, Adobe Acrobat, and document management systems; Hourly rate depending on depth and years of experience ($30 – 35/hour)

Annual performance reviews with potential for sizeable increase in salary

Hybrid or remote work environment

Medical Insurance – Currently provided by United Healthcare with multiple insurance plans to choose from based on your needs – partially paid for by Firm for the employee; Optional Voluntary Life and Disability Insurance

Optional Health Savings Account

Optional Flexible Spending Account

Lydecker is an AV-rated full-service law firm with over 150 attorneys Nationwide! Our vision at Lydecker is to be a trusted partner that redefines excellence in legal services. We envision a future where our innovative approach to client service sets new standards in the legal industry. Together, we will shape the future of legal practice, empowering individuals and clients to thrive in an ever-evolving world.

At Lydecker, our mission is simple: to exceed client expectations with efficient, strategic, and collaborative service. We are dedicated to long-term success for our clients, attorneys, and staff, fostering a culture of excellence and teamwork.

We strive for the highest standards of quality, professionalism, and innovation in delivering legal services. Care: We take care of our people because we genuinely care about each one of them, and we believe that by fostering a culture of care, we can create a more resilient, supportive, and successful organization for all. We show that we care about our employees through employee well-being, professional growth and development, work-life balance, diversity and inclusion, and community engagement.

We are a growing national litigation firm built on the traditional values of hard work and taking care of our clients.

  • Diverse and Inclusive Ownership & Administrative Leadership. We take pride in having a significant portion of our attorneys and administrative leadership being a part of diverse groups. Many of our Firm's Shareholders and Administrative Leadership Team self-identify as historically underrepresented groups such as people of color, women, persons with disabilities, and/or LGBTQIA+.
  • Experience swift career progression, hands-on litigation learning, and abundant opportunities for professional development with mentoring from more senior attorneys in small, collaborative practice groups.
  • Flexible Work-Life Integration. We value your need to have a flexible schedule and work from home and hybrid work opportunities. Competitive salaries, quarterly bonus opportunities based on billable hours, paid time off, top-notch medical insurance with no copay for outpatient mental health access, paid parking or commuter benefits, and a robust 401k plan.

To learn more about Lydecker LLP, please visit our website at or visit LinkedIn #LydeckerCareers #LydeckerLife #LydeckerAuthenticDiversity

Lydecker LLP is an Equal Opportunity Employer and does not discriminate based on race, color, religion, sex, sexual orientation, gender identity or expression, national origin, age, disability, veteran status, marital status, or based on an individual’s status in any group or class protected by applicable federal, state, or local law.

This employer is required to notify all applicants of their rights pursuant to federal employment laws.

Vacancy posted 4 days ago
Similar jobs that could be interesting for youBased on the Paralegal - Legal Services - remote in Los Angeles, CA vacancy
  • $60k - $100k

     ...Responsibilities Support lawyers in the Firm’s legal departments, as a part of legal support team model Assist attorneys in the litigation department in all phases of litigation including motion practice, discovery, trial and post-trial Assist with accurately editing and... 
    Suggested
    Work at office
    Local area

    Proskauer Rose

    Los Angeles, CA
    14 hours ago
  • $38.46 - $47.44 per hour

     ...Position Summary This executive assistant role is responsible for providing high-level, executive and confidential administrative support...  ...organization. Job Duties And Responsibilities Specialized legal support leading to exceptional client service. Calendar management... 
    Suggested
    Hourly pay
    Full time
    Temporary work
    Casual work
    Work at office
    Remote work
    Flexible hours
    Afternoon shift

    Reed Smith

    Los Angeles, CA
    2 days ago
  •  ...national law firm known for its collaborative environment, long-standing client relationships, and commitment to providing high-quality legal services across a variety of practice areas.Job DescriptionKey Responsibilities:Manage attorney calendars, meetings, depositions,... 
    Suggested
    Local area

    Michael Page

    Los Angeles, CA
    1 day ago
  •  ...Our client, a respected law firm in Beverly Hills, is seeking a Legal Executive Assistant to join its team. This is an exciting opportunity for someone who enjoys being a trusted right-hand and thrives in a busy legal environment. You'll support a practice group while... 
    Suggested
    Work at office

    Career Group

    Beverly Hills, CA
    2 days ago
  • $60k - $100k

     ...Job Description ResponsibilitiesSupport lawyers in the Firm’s legal departments, as a part of legal support team modelAssist attorneys...  ...and co-workersWork as part of a secretarial team and provide assistance to attorneysAssist in day-to-day duties such as faxing, filing,... 
    Suggested
    Full time
    Contract work
    Work at office
    Local area
    Relocation package

    Fairweather

    Los Angeles, CA
    1 day ago
  • $80k - $100k

     ...Salary: USD80000 - USD100000 per year Legal Executive Assistant Business: Adams & Martin Group About the Opportunity: A respected Los Angeles-based professional services organization is seeking an experienced Executive Assistant to provide high-level support to a senior... 
    Full time
    Work at office
    Monday to Friday

    ADAM'S

    Los Angeles, CA
    4 days ago
  •  ...Reed Smith LLP in Los Angeles is seeking an executive assistant to provide high‑level, confidential administrative support to the attorney and practice team. You will coordinate calendar, travel, and meetings across time zones while liaising with clients and vendors. Five... 
    Work at office

    Reed Smith

    Los Angeles, CA
    3 days ago
  •  ...This Legal Executive Assistant role supports attorneys with calendaring, court filings, legal document preparation, billing, travel coordination, and otherhigh-leveladministrativeresponsibilitiesinafast-pacedlawfirmenvironment.Theidealcandidatehaspriorlegalsupportexperience... 
    Local area

    PageGroup

    Los Angeles, CA
    21 hours ago
  • $210k - $270k

     ...insurance; paid time off; paid parental leave; 401(k) with employer contribution; family/dependent care leave; FSA/HSA; and an employee assistance programAdditional Benefits: Optional critical care, accident and hospital indemnity coverage, domestic partner benefits, student... 

    Technology Recruiting Solutions

    Los Angeles, CA
    2 days ago
  • $260k

     ...apply, please complete the online application, attaching a resume, cover letter, and law school transcript addressed to: Ross Cummings, Legal Senior Recruitment Coordinator, Hogan Lovells Cadwalader US LLP, 4 Embarcadero Center Suite 3500, San Francisco, CA 94111.All search... 
    Full time
    Work at office
    Relocation

    Hogan Lovells

    Los Angeles, CA
    1 day ago
  • $195k - $215k

     ...oral advocacy) and trial experience are strongly preferred.Proven legal research, writing, and analytical capabilitiesExcellent...  ...client service and effective teamwork.Key ResponsibilitiesManage and assist with high-stakes business litigation matters across industriesConduct... 

    Client Growth Resources

    Los Angeles, CA
    4 days ago
  • $100k - $130k

     ...transactions and disputes. Our exceptional teams craft and deploy creative legal strategies that are meticulously tailored to every matter,...  ...trademarks, patents, copyrights, and domain names. Assist with the preparation and filing of TTAB proceedings. Drafting... 
    Full time
    Work at office
    Local area
    Immediate start
    Flexible hours

    Gibson Dunn

    Los Angeles, CA
    3 days ago
  • $45k - $60k

     ...Legal Assistant PositionDirect hire, full-time position in an office located in Glendale, CA. Salary: $45k-60k. This law office covers personal injury, employment, criminal, and WC (defense). Business casual environment in a boutique law firm office setting. Full-time... 
    Full time
    Casual work
    Work at office
    Local area

    JBA International

    Glendale, CA
    3 days ago
  • Employment Litigation Associate (3–5 Years) A nationally recognized firm is seeking a mid-level Labor & Employment Associate (3–5 years) to join its premier Los Angeles office. This is an exceptional opportunity for a high-performing employment litigator who thrives on...
    Work at office

    Scion Legal Staffing

    Los Angeles, CA
    1 day ago
  • $260k - $365k

     ...rankings from leading directories and publications, speaking to our legal capabilities, dedication to creating an inclusive workplace,...  ..., including free access to health care advocates, Employee Assistance Program, Talkspace, and Calm apps.Flex Time Away and reduced schedule... 
    Local area
    Flexible hours

    Morrison & Foerster

    Los Angeles, CA
    1 day ago
  • $125k - $200k

    Hinshaw & Culbertson, a leading national law firm, seeks an attorney to join its Defense Litigation practice group.This position offers the opportunity to work with a collaborative team, representing national and international insurance clients in a wide range of complex...
    Work at office
    Remote work

    Hinshaw & Culbertson

    Los Angeles, CA
    4 days ago
  • $420k

     ...and references;5. Willingness to commit to excellent client service and a client-centered practice;6. Comfort with analyzing complex legal issues, for example, jurisdictional, choice-of-law, and admiralty law issues;7. Clerkship experience, especially at the appellate... 
    Full time
    Worldwide

    Perkins Coie

    Los Angeles, CA
    1 day ago
  • $310k - $390k

     ...academic credentials;4. Willingness to commit to excellent client service and a client-centered practice;5. Comfort with analyzing complex legal issues, for example contractual, jurisdictional, choice-of-law, and admiralty law issues;6. Clerkship experience, especially at the... 
    Full time
    Worldwide

    Perkins Coie

    Los Angeles, CA
    1 day ago
  • $90k - $110k

     ...Corporate Legal Paralegal $90,000 - $110,000 per year | Los Angeles, CA | On‑Site | Permanent Corporate Legal Paralegal needed for Top...  ...regulatory filings. Strong organizational skills with the ability to assist on litigation matters (approximately 20% of workload) including... 
    Permanent employment

    Australia-Employment

    Los Angeles, CA
    14 hours ago
  • $120k - $140k

     ...Jobot California Worker Privacy Notice and Jobot Notice Regarding Automated Employment Decision Tools which are available at jobot.com/legal. By applying for this job, you agree to receive calls, AI-generated calls, text messages, or emails from Jobot, and/or its agents... 
    Local area

    Jobot

    Los Angeles, CA
    4 days ago
  • $80k - $110k

     ...Litigation Legal Assistant / Legal Secretary (No Family Law Experience required) $80,000 - $110,000 per year | Los Angeles, CA | On‑Site | Permanent Legal Assistant / Secretary Opportunity with Prestigious Los Angeles Family Law Firm Based in Los Angeles, CA, this boutique... 
    Permanent employment
    Work at office
    Local area
    Flexible hours

    Australia-Employment

    Los Angeles, CA
    3 days ago
  • $500 per month

     ...Job Title: Litigation Legal Administrative Assistant Location: Century City CA 90067 OR Irvine CA 92614 Salary/Payrate: $90K-$110K annually bonus and AWESOME benefits!!! Work Environment: Hybrid (1 day WFH per week) Term: Permanent / Fulltime Bachelor’s degree required... 
    Permanent employment
    Full time
    Work from home
    Shift work
    1 day per week

    AMS Staffing Inc.

    Los Angeles, CA
    1 day ago
  • $210k - $260k

     ...experience preferred ~ Experience handling California wage-and-hour class actions and PAGA cases is highly preferred ~ Strong legal research, writing, and analytical skills ~ Ability to manage multiple projects and deadlines independently ~ Comfortable... 
    Work at office
    Flexible hours

    Boutique Recruiting

    Los Angeles, CA
    14 hours ago
  •  ...representing employers. Strong experience handling employment-related administrative charges and court litigation. Excellent legal research, analytical, writing, and oral advocacy skills. Ability to manage multiple priorities and cases effectively. Strong client... 
    Local area

    Adams & Martin Group

    Pasadena, CA
    1 day ago
  •  ...Appeals and E-Filings. Prepares correspondence, memoranda and other legal documents from written and oral drafts; drafts standard...  ...and other documents. Prepares discovery and pleading shells and assists with document productions. Assists with trial preparation, including... 
    Permanent employment
    Temporary work
    Work at office
    Local area

    Barnes & Thornburg

    Los Angeles, CA
    1 day ago
  • $230k - $250k

     ...(k) Retirement Plan ~ Flexible Spending and Health Savings Account ~ Firm-paid holidays, vacation and sick time ~ Employee assistance program and other firm benefits We are an equal employment opportunity employer. All qualified applicants will receive consideration... 
    Contract work
    Work at office
    Local area
    Flexible hours

    Jackson Lewis

    Los Angeles, CA
    1 day ago
  • $30 - $37 per hour

     ...with Gray Duffy Eisenbaum & Lee Are you an experienced litigation legal secretary who takes pride in keeping cases organized, deadlines...  ..., and other important events. Coordinate attorney calendars and assist with scheduling. Prepare routine correspondence and documents... 
    Hourly pay
    Full time
    Work at office
    Local area
    Remote work
    Flexible hours

    Gray Duffy Eisenbaum & Lee

    Los Angeles, CA
    2 days ago
  • $100k - $120k

     ...invoices and manage reimbursements. Manage travel arrangements and assist with attorney time entry as needed. Support the firm and peers...  ...diploma is required At least 5 years’ experience performing legal administrative duties in a law firm or professional service organization... 
    Full time
    Work at office
    Local area
    Relocation
    3 days per week

    INTEGR8STAFF LLC

    Santa Monica, CA
    3 days ago
  •  ...Job Title: Litigation Legal Secretary Location: Los Angeles, CA 90017 Salary: $100K–$120K annually, bonus and benefits. Work Environment: Onsite (3 days work‑from‑home, 2 days onsite), typically Tuesday, Wednesday, Thursday onsite. Term: Permanent / Full‑time. Overview... 
    Permanent employment
    Full time
    Work at office
    Local area
    Work from home

    AMS Staffing Inc.

    Los Angeles, CA
    3 days ago
  •  ...and collaborative culture, is seeking an experienced Litigation Legal Secretary to join their team. This is an exceptional...  ...ideal candidate will have litigation legal secretary or legal assistant experience, and a strong understanding of court procedures and... 

    Bridgeline Solutions

    Los Angeles, CA
    3 days ago

Do you want to receive more vacancies?

Subscribe and receive similar vacancies to Paralegal - Legal Services - remote. Be the first to apply!