Paralegal - Legal Services - remote
$30 - $35 per hourLydecker LLP
If you possess a strong work ethic, exceptional organizational skills, strong attention to detail, and want to work in our growing defense litigation practice group, this may be the opportunity for you!
This is a hybrid for our office in LA 90014.
A minimum of 2 years of civil defense litigation experience, preferably in General Liability, Labor and employment, Personal Injury, or other civil defense litigation practice area; previous insurance defense litigation a huge plus.
Previous experience should include experience with calendaring, docketing, interfacing with court personnel, opposing counsel, clients and vendors, drafting basic pleadings and legal correspondence
Computer skills: Has basic knowledge of computer operation, internet software, spreadsheet software and word processing software; the use of Microsoft products is preferred. Has the ability to type and operate office equipment.
Detail-oriented with a keen eye for accuracy, proofreading, and editing legal documents for consistency and completeness
Associate degree or Bachelor degree a plus, but not required
Support attorneys by performing various administrative duties, such as maintaining calendars, managing hearings and deadlines, organizing case files, and coordinating logistics
Support attorneys by e-filing documents in state or federal court as needed
Expertly organize exhibits, documents, evidence, briefs, and appendices for efficient reference and retrieval (we use Clio)
Draft basic pleadings such as EOAs, Notices, Motions, discovery, under the supervision of the attorneys
Familiarity with Microsoft Outlook, Word, Excel, Adobe Acrobat, and document management systems; Hourly rate depending on depth and years of experience ($30 – 35/hour)
Annual performance reviews with potential for sizeable increase in salary
Hybrid or remote work environment
Medical Insurance – Currently provided by United Healthcare with multiple insurance plans to choose from based on your needs – partially paid for by Firm for the employee; Optional Voluntary Life and Disability Insurance
Optional Health Savings Account
Optional Flexible Spending Account
Lydecker is an AV-rated full-service law firm with over 150 attorneys Nationwide! Our vision at Lydecker is to be a trusted partner that redefines excellence in legal services. We envision a future where our innovative approach to client service sets new standards in the legal industry. Together, we will shape the future of legal practice, empowering individuals and clients to thrive in an ever-evolving world.
At Lydecker, our mission is simple: to exceed client expectations with efficient, strategic, and collaborative service. We are dedicated to long-term success for our clients, attorneys, and staff, fostering a culture of excellence and teamwork.
We strive for the highest standards of quality, professionalism, and innovation in delivering legal services. Care: We take care of our people because we genuinely care about each one of them, and we believe that by fostering a culture of care, we can create a more resilient, supportive, and successful organization for all. We show that we care about our employees through employee well-being, professional growth and development, work-life balance, diversity and inclusion, and community engagement.
We are a growing national litigation firm built on the traditional values of hard work and taking care of our clients.
- Diverse and Inclusive Ownership & Administrative Leadership. We take pride in having a significant portion of our attorneys and administrative leadership being a part of diverse groups. Many of our Firm's Shareholders and Administrative Leadership Team self-identify as historically underrepresented groups such as people of color, women, persons with disabilities, and/or LGBTQIA+.
- Experience swift career progression, hands-on litigation learning, and abundant opportunities for professional development with mentoring from more senior attorneys in small, collaborative practice groups.
- Flexible Work-Life Integration. We value your need to have a flexible schedule and work from home and hybrid work opportunities. Competitive salaries, quarterly bonus opportunities based on billable hours, paid time off, top-notch medical insurance with no copay for outpatient mental health access, paid parking or commuter benefits, and a robust 401k plan.
To learn more about Lydecker LLP, please visit our website at or visit LinkedIn #LydeckerCareers #LydeckerLife #LydeckerAuthenticDiversity
Lydecker LLP is an Equal Opportunity Employer and does not discriminate based on race, color, religion, sex, sexual orientation, gender identity or expression, national origin, age, disability, veteran status, marital status, or based on an individual’s status in any group or class protected by applicable federal, state, or local law.
This employer is required to notify all applicants of their rights pursuant to federal employment laws.
$60k - $100k
...Responsibilities Support lawyers in the Firm’s legal departments, as a part of legal support team model Assist attorneys in the litigation department in all phases of litigation including motion practice, discovery, trial and post-trial Assist with accurately editing and...SuggestedWork at officeLocal area$38.46 - $47.44 per hour
...Position Summary This executive assistant role is responsible for providing high-level, executive and confidential administrative support... ...organization. Job Duties And Responsibilities Specialized legal support leading to exceptional client service. Calendar management...SuggestedHourly payFull timeTemporary workCasual workWork at officeRemote workFlexible hoursAfternoon shift- ...national law firm known for its collaborative environment, long-standing client relationships, and commitment to providing high-quality legal services across a variety of practice areas.Job DescriptionKey Responsibilities:Manage attorney calendars, meetings, depositions,...SuggestedLocal area
- ...Our client, a respected law firm in Beverly Hills, is seeking a Legal Executive Assistant to join its team. This is an exciting opportunity for someone who enjoys being a trusted right-hand and thrives in a busy legal environment. You'll support a practice group while...SuggestedWork at office
$60k - $100k
...Job Description ResponsibilitiesSupport lawyers in the Firm’s legal departments, as a part of legal support team modelAssist attorneys... ...and co-workersWork as part of a secretarial team and provide assistance to attorneysAssist in day-to-day duties such as faxing, filing,...SuggestedFull timeContract workWork at officeLocal areaRelocation package$80k - $100k
...Salary: USD80000 - USD100000 per year Legal Executive Assistant Business: Adams & Martin Group About the Opportunity: A respected Los Angeles-based professional services organization is seeking an experienced Executive Assistant to provide high-level support to a senior...Full timeWork at officeMonday to Friday- ...Reed Smith LLP in Los Angeles is seeking an executive assistant to provide high‑level, confidential administrative support to the attorney and practice team. You will coordinate calendar, travel, and meetings across time zones while liaising with clients and vendors. Five...Work at office
- ...This Legal Executive Assistant role supports attorneys with calendaring, court filings, legal document preparation, billing, travel coordination, and otherhigh-leveladministrativeresponsibilitiesinafast-pacedlawfirmenvironment.Theidealcandidatehaspriorlegalsupportexperience...Local area
$210k - $270k
...insurance; paid time off; paid parental leave; 401(k) with employer contribution; family/dependent care leave; FSA/HSA; and an employee assistance programAdditional Benefits: Optional critical care, accident and hospital indemnity coverage, domestic partner benefits, student...$260k
...apply, please complete the online application, attaching a resume, cover letter, and law school transcript addressed to: Ross Cummings, Legal Senior Recruitment Coordinator, Hogan Lovells Cadwalader US LLP, 4 Embarcadero Center Suite 3500, San Francisco, CA 94111.All search...Full timeWork at officeRelocation$195k - $215k
...oral advocacy) and trial experience are strongly preferred.Proven legal research, writing, and analytical capabilitiesExcellent... ...client service and effective teamwork.Key ResponsibilitiesManage and assist with high-stakes business litigation matters across industriesConduct...$100k - $130k
...transactions and disputes. Our exceptional teams craft and deploy creative legal strategies that are meticulously tailored to every matter,... ...trademarks, patents, copyrights, and domain names. Assist with the preparation and filing of TTAB proceedings. Drafting...Full timeWork at officeLocal areaImmediate startFlexible hours$45k - $60k
...Legal Assistant PositionDirect hire, full-time position in an office located in Glendale, CA. Salary: $45k-60k. This law office covers personal injury, employment, criminal, and WC (defense). Business casual environment in a boutique law firm office setting. Full-time...Full timeCasual workWork at officeLocal area- Employment Litigation Associate (3–5 Years) A nationally recognized firm is seeking a mid-level Labor & Employment Associate (3–5 years) to join its premier Los Angeles office. This is an exceptional opportunity for a high-performing employment litigator who thrives on...Work at office
$260k - $365k
...rankings from leading directories and publications, speaking to our legal capabilities, dedication to creating an inclusive workplace,... ..., including free access to health care advocates, Employee Assistance Program, Talkspace, and Calm apps.Flex Time Away and reduced schedule...Local areaFlexible hours$125k - $200k
Hinshaw & Culbertson, a leading national law firm, seeks an attorney to join its Defense Litigation practice group.This position offers the opportunity to work with a collaborative team, representing national and international insurance clients in a wide range of complex...Work at officeRemote work$420k
...and references;5. Willingness to commit to excellent client service and a client-centered practice;6. Comfort with analyzing complex legal issues, for example, jurisdictional, choice-of-law, and admiralty law issues;7. Clerkship experience, especially at the appellate...Full timeWorldwide$310k - $390k
...academic credentials;4. Willingness to commit to excellent client service and a client-centered practice;5. Comfort with analyzing complex legal issues, for example contractual, jurisdictional, choice-of-law, and admiralty law issues;6. Clerkship experience, especially at the...Full timeWorldwide$90k - $110k
...Corporate Legal Paralegal $90,000 - $110,000 per year | Los Angeles, CA | On‑Site | Permanent Corporate Legal Paralegal needed for Top... ...regulatory filings. Strong organizational skills with the ability to assist on litigation matters (approximately 20% of workload) including...Permanent employment$120k - $140k
...Jobot California Worker Privacy Notice and Jobot Notice Regarding Automated Employment Decision Tools which are available at jobot.com/legal. By applying for this job, you agree to receive calls, AI-generated calls, text messages, or emails from Jobot, and/or its agents...Local area$80k - $110k
...Litigation Legal Assistant / Legal Secretary (No Family Law Experience required) $80,000 - $110,000 per year | Los Angeles, CA | On‑Site | Permanent Legal Assistant / Secretary Opportunity with Prestigious Los Angeles Family Law Firm Based in Los Angeles, CA, this boutique...Permanent employmentWork at officeLocal areaFlexible hours$500 per month
...Job Title: Litigation Legal Administrative Assistant Location: Century City CA 90067 OR Irvine CA 92614 Salary/Payrate: $90K-$110K annually bonus and AWESOME benefits!!! Work Environment: Hybrid (1 day WFH per week) Term: Permanent / Fulltime Bachelor’s degree required...Permanent employmentFull timeWork from homeShift work1 day per week$210k - $260k
...experience preferred ~ Experience handling California wage-and-hour class actions and PAGA cases is highly preferred ~ Strong legal research, writing, and analytical skills ~ Ability to manage multiple projects and deadlines independently ~ Comfortable...Work at officeFlexible hours- ...representing employers. Strong experience handling employment-related administrative charges and court litigation. Excellent legal research, analytical, writing, and oral advocacy skills. Ability to manage multiple priorities and cases effectively. Strong client...Local area
- ...Appeals and E-Filings. Prepares correspondence, memoranda and other legal documents from written and oral drafts; drafts standard... ...and other documents. Prepares discovery and pleading shells and assists with document productions. Assists with trial preparation, including...Permanent employmentTemporary workWork at officeLocal area
$230k - $250k
...(k) Retirement Plan ~ Flexible Spending and Health Savings Account ~ Firm-paid holidays, vacation and sick time ~ Employee assistance program and other firm benefits We are an equal employment opportunity employer. All qualified applicants will receive consideration...Contract workWork at officeLocal areaFlexible hours$30 - $37 per hour
...with Gray Duffy Eisenbaum & Lee Are you an experienced litigation legal secretary who takes pride in keeping cases organized, deadlines... ..., and other important events. Coordinate attorney calendars and assist with scheduling. Prepare routine correspondence and documents...Hourly payFull timeWork at officeLocal areaRemote workFlexible hours$100k - $120k
...invoices and manage reimbursements. Manage travel arrangements and assist with attorney time entry as needed. Support the firm and peers... ...diploma is required At least 5 years’ experience performing legal administrative duties in a law firm or professional service organization...Full timeWork at officeLocal areaRelocation3 days per week- ...Job Title: Litigation Legal Secretary Location: Los Angeles, CA 90017 Salary: $100K–$120K annually, bonus and benefits. Work Environment: Onsite (3 days work‑from‑home, 2 days onsite), typically Tuesday, Wednesday, Thursday onsite. Term: Permanent / Full‑time. Overview...Permanent employmentFull timeWork at officeLocal areaWork from home
- ...and collaborative culture, is seeking an experienced Litigation Legal Secretary to join their team. This is an exceptional... ...ideal candidate will have litigation legal secretary or legal assistant experience, and a strong understanding of court procedures and...
Do you want to receive more vacancies?
Subscribe and receive similar vacancies to Paralegal - Legal Services - remote. Be the first to apply!
- administrative legal assistant Los Angeles, CA
- paralegal document review Los Angeles, CA
- temporary legal assistant Los Angeles, CA
- personal injury legal assistant Los Angeles, CA
- estate paralegal Los Angeles, CA
- real estate legal assistant Los Angeles, CA
- travel paralegal Los Angeles, CA
- law clerk part time Los Angeles, CA
- trademark paralegal Los Angeles, CA
- paralegal Los Angeles, CA

